PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_017197-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family bHLH
Protein Properties Length: 162aa    MW: 18478.3 Da    PI: 6.748
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_017197-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH30.75.5e-101461655
                   HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
            HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                     +E+ RR+++++ ++eL +l+P+   ++++ +   +  e+A++YIk+Lq
  NNU_017197-RA 14 RTVEKIRRNHMKNLYAELNSLIPSH--GTKETMALPDQIEEATNYIKMLQ 61
                   579*********************8..57777*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.83E-7765No hitNo description
PROSITE profilePS5088810.467860IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.83E-11973IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.7E-101272IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.1E-61461IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003538.1E-41466IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MEDYDHSSSK VDRRTVEKIR RNHMKNLYAE LNSLIPSHGT KETMALPDQI EEATNYIKML  60
QQKLERMKEK KASIMGLEGI TSGMMVRAKS PHIEIHDMGS ALQAVLVSGL DHHQLLFYEI  120
IRLLHDEGAE IVSASFSVVD NSVFHTIHAE LKREHLTSVL IF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272432.11e-107PREDICTED: transcription factor bHLH36-like
TrEMBLD7TRW28e-59D7TRW2_VITVI; Putative uncharacterized protein (Fragment)
TrEMBLA5C0F41e-58A5C0F4_VITVI; Putative uncharacterized protein
STRINGVIT_00s0479g00020.t012e-58(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.14e-37bHLH family protein